PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_460508g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 251aa    MW: 28391.9 Da    PI: 7.373
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_460508g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.46.1e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W +eEd +l d+++++G g+W++ ++  g+ R++k+c++rw +yl
   MA_460508g0010 14 KGPWNPEEDRKLMDYIQKYGFGNWRALPKQAGLMRCGKSCRLRWMNYL 61
                     79********************************************97 PP

2Myb_DNA-binding48.22.4e-1567111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ ++eE++ +v+++++lG++ W+tIa++++ gRt++++k+ w++ 
   MA_460508g0010  67 RGSLSPEEEQTIVRLHRLLGNR-WSTIASCLP-GRTDNEIKNIWNSN 111
                      7888******************.*********.*********99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.946965IPR017930Myb domain
SuperFamilySSF466893.25E-3012108IPR009057Homeodomain-like
SMARTSM007175.0E-131363IPR001005SANT/Myb domain
PfamPF002491.1E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-241568IPR009057Homeodomain-like
CDDcd001671.77E-111661No hitNo description
SMARTSM007177.9E-1366114IPR001005SANT/Myb domain
PROSITE profilePS5129416.41966116IPR017930Myb domain
PfamPF002492.7E-1367111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.9E-2469115IPR009057Homeodomain-like
CDDcd001677.17E-1071112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MGRAPCCDKM AVKKGPWNPE EDRKLMDYIQ KYGFGNWRAL PKQAGLMRCG KSCRLRWMNY  60
LRPDLKRGSL SPEEEQTIVR LHRLLGNRWS TIASCLPGRT DNEIKNIWNS NLKKRFTQSG  120
CGRNPLSAHS SSSTVPTIPV SVNNCLSKSL AMENSHCFLG SPNSTCSFSY SKESEPQFTA  180
DQIGIYGAEY DQPLWETISA RRHETDENKS AHDYINCLKK FLDIAEESSL QEHGSEDCDI  240
AGVSDHISED Y
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-30141167108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00249DAPTransfer from AT1G79180Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003580139.16e-64PREDICTED: myb-related protein Myb4-like
TrEMBLA0A0D6QWR77e-70A0A0D6QWR7_ARACU; Uncharacterized protein
STRINGBRADI5G15760.12e-63(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.19e-65myb domain protein 14